| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor ligand superfamily member 11 |
|---|
| Ligand | BDBM50525148 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1895787 (CHEMBL4397822) |
|---|
| IC50 | 26200±n/a nM |
|---|
| Citation |  Jiang, M; Peng, L; Yang, K; Wang, T; Yan, X; Jiang, T; Xu, J; Qi, J; Zhou, H; Qian, N; Zhou, Q; Chen, B; Xu, X; Deng, L; Yang, C Development of Small-Molecules Targeting Receptor Activator of Nuclear Factor-?B Ligand (RANKL)-Receptor Activator of Nuclear Factor-?B (RANK) Protein-Protein Interaction by Structure-Based Virtual Screening and Hit Optimization. J Med Chem62:5370-5381 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor ligand superfamily member 11 |
|---|
| Name: | Tumor necrosis factor ligand superfamily member 11 |
|---|
| Synonyms: | CD_antigen=CD254 | ODF | OPGL | RANKL | TNF11_HUMAN | TNFSF11 | TRANCE |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35484.75 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_106141 |
|---|
| Residue: | 317 |
|---|
| Sequence: | MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQV
VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK
QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD
PDQDATYFGAFKVRDID
|
|
|
|---|
| BDBM50525148 |
|---|
| n/a |
|---|
| Name | BDBM50525148 |
|---|
| Synonyms: | CHEMBL1978769 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H27N3O3 |
|---|
| Mol. Mass. | 441.5216 |
|---|
| SMILES | Cc1cccc(C)c1NC(=O)C(Cc1c[nH]c2ccccc12)NC(=O)OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
