Reaction Details |
| Report a problem with these data |
Target | Orexin/Hypocretin receptor type 1 |
---|
Ligand | BDBM50526572 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1900190 (CHEMBL4402305) |
---|
Ki | 502±n/a nM |
---|
Citation | Yamamoto, N; Ohrui, S; Okada, T; Saitoh, T; Kutsumura, N; Nagumo, Y; Irukayama-Tomobe, Y; Ogawa, Y; Ishikawa, Y; Watanabe, Y; Hayakawa, D; Gouda, H; Yanagisawa, M; Nagase, H Essential structure of orexin 1 receptor antagonist YNT-707, part III: Role of the 14-hydroxy and the 3-methoxy groups in antagonistic activity toward the orexin 1 receptor in YNT-707 derivatives lacking the 4,5-epoxy ring. Bioorg Med Chem27:1747-1758 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Orexin/Hypocretin receptor type 1 |
---|
Name: | Orexin/Hypocretin receptor type 1 |
Synonyms: | HCRTR1 | Hypocretin receptor type 1 | OX1R_HUMAN | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r |
Type: | Protein |
Mol. Mass.: | 47554.50 |
Organism: | Homo sapiens (Human) |
Description: | O43613 |
Residue: | 425 |
Sequence: | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
|
|
|
BDBM50526572 |
---|
n/a |
---|
Name | BDBM50526572 |
Synonyms: | CHEMBL4442127 |
Type | Small organic molecule |
Emp. Form. | C31H32N2O5S |
Mol. Mass. | 544.661 |
SMILES | COc1ccc2C[C@H]3N(CC[C@@]4(C[C@H](CC=C34)N(C)C(=O)\C=C\c3ccoc3)c2c1)S(=O)(=O)c1ccccc1 |r,t:15,THB:30:8:5.28.6:16| |
Structure |
|