| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50531666 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1920576 (CHEMBL4423421) |
|---|
| EC50 | 1350±n/a nM |
|---|
| Citation |  Li, Z; Chen, Y; Zhou, Z; Deng, L; Xu, Y; Hu, L; Liu, B; Zhang, L Discovery of first-in-class thiazole-based dual FFA1/PPAR? agonists as potential anti-diabetic agents. Eur J Med Chem164:352-365 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 31473.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O14842 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
|---|
| BDBM50531666 |
|---|
| n/a |
|---|
| Name | BDBM50531666 |
|---|
| Synonyms: | CHEMBL4454699 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16FNO5 |
|---|
| Mol. Mass. | 357.3324 |
|---|
| SMILES | Cc1nc(oc1COc1ccc(OCC(O)=O)c(F)c1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
