| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50468846 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1925211 (CHEMBL4428283) |
|---|
| IC50 | 860±n/a nM |
|---|
| Citation |  Tang, J; Liu, F; Nagy, E; Miller, L; Kirby, KA; Wilson, DJ; Wu, B; Sarafianos, SG; Parniak, MA; Wang, Z 3-Hydroxypyrimidine-2,4-diones as Selective Active Site Inhibitors of HIV Reverse Transcriptase-Associated RNase H: Design, Synthesis, and Biochemical Evaluations. J Med Chem59:2648-59 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50468846 |
|---|
| n/a |
|---|
| Name | BDBM50468846 |
|---|
| Synonyms: | CHEMBL4291913 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12ClN3O3 |
|---|
| Mol. Mass. | 329.738 |
|---|
| SMILES | On1c(=O)cc(Nc2cccc(c2)-c2ccc(Cl)cc2)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
