| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein tyrosine phosphatase type IVA 1 |
|---|
| Ligand | BDBM396097 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1931303 (CHEMBL4434554) |
|---|
| IC50 | 50±n/a nM |
|---|
| Citation |  Tasker, NR; Rastelli, EJ; Burnett, JC; Sharlow, ER; Lazo, JS; Wipf, P Tapping the therapeutic potential of protein tyrosine phosphatase 4A with small molecule inhibitors. Bioorg Med Chem Lett29:2008-2015 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein tyrosine phosphatase type IVA 1 |
|---|
| Name: | Protein tyrosine phosphatase type IVA 1 |
|---|
| Synonyms: | PRL1 | PTP4A1 | PTPCAAX1 | TP4A1_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19823.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1461024 |
|---|
| Residue: | 173 |
|---|
| Sequence: | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
|
|
|
|---|
| BDBM396097 |
|---|
| n/a |
|---|
| Name | BDBM396097 |
|---|
| Synonyms: | US10308663, JMS-631-053 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H8N2O2S |
|---|
| Mol. Mass. | 256.28 |
|---|
| SMILES | N=C1c2sc(cc2C(=O)NC1=O)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
