| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Farnesyl pyrophosphate synthase |
|---|
| Ligand | BDBM25271 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1935623 (CHEMBL4481382) |
|---|
| IC50 | 230±n/a nM |
|---|
| Citation |  Malwal, SR; Chen, L; Hicks, H; Qu, F; Liu, W; Shillo, A; Law, WX; Zhang, J; Chandnani, N; Han, X; Zheng, Y; Chen, CC; Guo, RT; AbdelKhalek, A; Seleem, MN; Oldfield, E Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis. J Med Chem62:2564-2581 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Farnesyl pyrophosphate synthase |
|---|
| Name: | Farnesyl pyrophosphate synthase |
|---|
| Synonyms: | Dimethylallyltranstransferase | FDPS | FPP synthase | FPP synthetase | FPPS_HUMAN | FPS | Farnesyl diphosphate synthase | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | KIAA1293 | P14324 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 48272.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14324 |
|---|
| Residue: | 419 |
|---|
| Sequence: | MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
|
|
|
|---|
| BDBM25271 |
|---|
| n/a |
|---|
| Name | BDBM25271 |
|---|
| Synonyms: | 3-[(3,7-dimethyloctyl)oxy]-1-(2-hydrogen phosphonato-2-phosphonoethyl)pyridin-1-ium | bisphosphonate, 24 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H31NO7P2 |
|---|
| Mol. Mass. | 423.3781 |
|---|
| SMILES | CC(C)CCCC(C)CCOc1ccc[n+](CC(P(O)(O)=O)P(O)([O-])=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
