Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM50104682 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_214524 (CHEMBL819516) |
---|
IC50 | 14500±n/a nM |
---|
Citation | Sodeoka, M; Sampe, R; Kojima, S; Baba, Y; Usui, T; Ueda, K; Osada, H Synthesis of a tetronic acid library focused on inhibitors of tyrosine and dual-specificity protein phosphatases and its evaluation regarding VHR and cdc25B inhibition. J Med Chem44:3216-22 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM50104682 |
---|
n/a |
---|
Name | BDBM50104682 |
Synonyms: | 4-Hydroxy-5-hydroxymethyl-2-oxo-2,5-dihydro-furan-3-carboxylic acid tetradecyl ester | CHEMBL323984 |
Type | Small organic molecule |
Emp. Form. | C20H34O6 |
Mol. Mass. | 370.4804 |
SMILES | CCCCCCCCCCCCCCOC(=O)c1c(O)oc(CO)c1O |
Structure |
|