| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM50104698 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_214524 (CHEMBL819516) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Sodeoka, M; Sampe, R; Kojima, S; Baba, Y; Usui, T; Ueda, K; Osada, H Synthesis of a tetronic acid library focused on inhibitors of tyrosine and dual-specificity protein phosphatases and its evaluation regarding VHR and cdc25B inhibition. J Med Chem44:3216-22 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM50104698 |
|---|
| n/a |
|---|
| Name | BDBM50104698 |
|---|
| Synonyms: | 5-Hydroxymethyl-4-methoxy-2-oxo-2,5-dihydro-furan-3-carboxylic acid tetradecyl ester | CHEMBL111454 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H36O6 |
|---|
| Mol. Mass. | 384.5069 |
|---|
| SMILES | CCCCCCCCCCCCCCOC(=O)C1=C(OC)[C@@H](CO)OC1=O |c:17| |
|---|
| Structure | 
|
|---|
Search and Browse
