Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM4164 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_159462 (CHEMBL878769) |
---|
IC50 | 2.8±n/a nM |
---|
Citation | Huang, X; Xu, L; Luo, X; Fan, K; Ji, R; Pei, G; Chen, K; Jiang, H Elucidating the inhibiting mode of AHPBA derivatives against HIV-1 protease and building predictive 3D-QSAR models. J Med Chem45:333-43 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM4164 |
---|
n/a |
---|
Name | BDBM4164 |
Synonyms: | (2S,4S)-N-tert-butyl-4-chloro-1-[(2S,3S)-2-hydroxy-3-[(3-hydroxy-2,6-dimethylphenyl)formamido]-4-(naphthalen-2-yl)butanoyl]pyrrolidine-2-carboxamide | (3-Hydroxy-2,6-dimethylbenzoyl)-{2(S)-hydroxy-3(S)-amino-4-(beta-naphtyl)-butanoyl}-4(S)-Cl-Pro-NH-t-Bu | AHPBA deriv. 49 | CHEMBL324710 |
Type | Small organic molecule |
Emp. Form. | C32H38ClN3O5 |
Mol. Mass. | 580.114 |
SMILES | Cc1ccc(O)c(C)c1C(=O)N[C@@H](Cc1ccc2ccccc2c1)[C@H](O)C(=O)N1C[C@@H](Cl)C[C@H]1C(=O)NC(C)(C)C |r| |
Structure |
|