Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-2 |
---|
Ligand | BDBM50550642 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2027958 (CHEMBL4682116) |
---|
IC50 | 440±n/a nM |
---|
Citation | Xie, SC; Gillett, DL; Spillman, NJ; Tsu, C; Luth, MR; Ottilie, S; Duffy, S; Gould, AE; Hales, P; Seager, BA; Charron, CL; Bruzzese, F; Yang, X; Zhao, X; Huang, SC; Hutton, CA; Burrows, JN; Winzeler, EA; Avery, VM; Dick, LR; Tilley, L Target Validation and Identification of Novel Boronate Inhibitors of the Plasmodium falciparum Proteasome. J Med Chem61:10053-10066 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-2 |
---|
Name: | Proteasome subunit beta type-2 |
Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
Type: | PROTEIN |
Mol. Mass.: | 22837.53 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1294233 |
Residue: | 201 |
Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
BDBM50550642 |
---|
n/a |
---|
Name | BDBM50550642 |
Synonyms: | CHEMBL4787081 |
Type | Small organic molecule |
Emp. Form. | C30H45BN4O7S |
Mol. Mass. | 616.577 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)NCC(C)(C)C)NS(=O)(=O)c1ccc(C)cc1)B(O)O |r| |
Structure |
|