Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50554406 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2049582 (CHEMBL4704281) |
---|
IC50 | 2.0±n/a nM |
---|
Citation | Barberis, C; Erdman, P; Czekaj, M; Fire, L; Pribish, J; Tserlin, E; Maniar, S; Batchelor, JD; Liu, J; Patel, VF; Hebert, A; Levit, M; Wang, A; Sun, F; Huang, SA Discovery of SARxxxx92, a pan-PIM kinase inhibitor, efficacious in a KG1 tumor model. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50554406 |
---|
n/a |
---|
Name | BDBM50554406 |
Synonyms: | CHEMBL4746428 |
Type | Small organic molecule |
Emp. Form. | C16H20ClFN4O |
Mol. Mass. | 338.808 |
SMILES | [H][C@]1(CCNC[C@@H]1F)[C@H](C)n1cc(C)c2c(Cl)cc(nc12)C(N)=O |r| |
Structure |
|