| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-C |
|---|
| Ligand | BDBM50563311 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2081913 (CHEMBL4737704) |
|---|
| Ki | 22±n/a nM |
|---|
| Citation |  Yu, M; Teo, T; Yang, Y; Li, M; Long, Y; Philip, S; Noll, B; Heinemann, GK; Diab, S; Eldi, P; Mekonnen, L; Anshabo, AT; Rahaman, MH; Milne, R; Hayball, JD; Wang, S Potent and orally bioavailable CDK8 inhibitors: Design, synthesis, structure-activity relationship analysis and biological evaluation. Eur J Med Chem214:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-C |
|---|
| Name: | Cyclin-C |
|---|
| Synonyms: | CCNC | CCNC_HUMAN | Cyclin C | SRB11 homolog | hSRB11 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33244.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_107900 |
|---|
| Residue: | 283 |
|---|
| Sequence: | MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQ
VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRF
SYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIV
NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQ
WKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
|
|
|
|---|
| BDBM50563311 |
|---|
| n/a |
|---|
| Name | BDBM50563311 |
|---|
| Synonyms: | CHEMBL4757811 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24ClN3O |
|---|
| Mol. Mass. | 405.92 |
|---|
| SMILES | Cc1ccc(-c2cncc(Cl)c2N2CCC3(CCNC3=O)CC2)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
