Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cyclin-C |
---|
Ligand | BDBM50563313 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2081913 (CHEMBL4737704) |
---|
Ki | 16±n/a nM |
---|
Citation | Yu, M; Teo, T; Yang, Y; Li, M; Long, Y; Philip, S; Noll, B; Heinemann, GK; Diab, S; Eldi, P; Mekonnen, L; Anshabo, AT; Rahaman, MH; Milne, R; Hayball, JD; Wang, S Potent and orally bioavailable CDK8 inhibitors: Design, synthesis, structure-activity relationship analysis and biological evaluation. Eur J Med Chem214:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-C |
---|
Name: | Cyclin-C |
Synonyms: | CCNC | CCNC_HUMAN | Cyclin C | SRB11 homolog | hSRB11 |
Type: | PROTEIN |
Mol. Mass.: | 33244.88 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_107900 |
Residue: | 283 |
Sequence: | MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQ
VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRF
SYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIV
NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQ
WKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
|
|
|
BDBM50563313 |
---|
n/a |
---|
Name | BDBM50563313 |
Synonyms: | CHEMBL4778713 |
Type | Small organic molecule |
Emp. Form. | C25H22ClN3O2 |
Mol. Mass. | 431.914 |
SMILES | Clc1cncc(-c2cccc3c4ccccc4oc23)c1N1CCC2(CCNC2=O)CC1 |
Structure |
|