| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 3A |
|---|
| Ligand | BDBM294361 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2085853 (CHEMBL4767116) |
|---|
| IC50 | 57±n/a nM |
|---|
| Citation |  Ko, K; Kim, HJ; Ho, PS; Lee, SO; Lee, JE; Min, CR; Kim, YC; Yoon, JH; Park, EJ; Kwon, YJ; Yun, JH; Yoon, DO; Kim, JS; Park, WS; Oh, SS; Song, YM; Cho, WK; Morikawa, K; Lee, KJ; Park, CH Discovery of a Novel Highly Selective Histamine H4 Receptor Antagonist for the Treatment of Atopic Dermatitis. J Med Chem61:2949-2961 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 3A |
|---|
| Name: | 5-hydroxytryptamine receptor 3A |
|---|
| Synonyms: | 5-HT-3 | 5-HT3 | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 (5-HT3) | 5-hydroxytryptamine receptor 3A (5-HT3a) | 5-hydroxytryptamine receptor 3A (5HT3A) | 5HT3A_HUMAN | 5HT3R | HTR3 | HTR3A | Serotonin 3 (5-HT3) receptor | Serotonin 3 receptor (5HT3) | Serotonin receptor 3A | Serotonin-gated ion channel receptor | Serotonin-gated ion channel receptor 3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 55283.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46098 |
|---|
| Residue: | 478 |
|---|
| Sequence: | MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
|
|
|
|---|
| BDBM294361 |
|---|
| n/a |
|---|
| Name | BDBM294361 |
|---|
| Synonyms: | US9586959, Compound 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H14ClN7 |
|---|
| Mol. Mass. | 303.75 |
|---|
| SMILES | CN1CCN(CC1)c1nc2ncc(Cl)cc2n2cnnc12 |
|---|
| Structure | 
|
|---|
Search and Browse
