| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Ligand | BDBM50566954 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2102069 (CHEMBL4810465) |
|---|
| Kd | 64000±n/a nM |
|---|
| Citation |  Blain, JM; Grote, DL; Watkins, SM; Goshu, GM; Muller, C; Gorman, JL; Ranieri, G; Walter, RL; Hofstetter, H; Horn, JR; Hagen, TJ Structural and biophysical characterization of the Burkholderia pseudomallei IspF inhibitor L-tryptophan hydroxamate. Bioorg Med Chem Lett48:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Name: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Synonyms: | ISPF_BURPS | MECDP-synthase | MECPP-synthase | MECPS | ispF | mecS |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17174.90 |
|---|
| Organism: | Burkholderia pseudomallei (strain K96243) |
|---|
| Description: | ChEMBL_107981 |
|---|
| Residue: | 162 |
|---|
| Sequence: | MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIG
RHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAA
DLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVREAAA
|
|
|
|---|
| BDBM50566954 |
|---|
| n/a |
|---|
| Name | BDBM50566954 |
|---|
| Synonyms: | CHEMBL4874588 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H13N3O2 |
|---|
| Mol. Mass. | 219.2398 |
|---|
| SMILES | N[C@H](Cc1c[nH]c2ccccc12)C(=O)NO |r| |
|---|
| Structure | 
|
|---|
Search and Browse
