Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Nonstructural protein 3 |
---|
Ligand | BDBM50567484 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2103470 (CHEMBL4811973) |
---|
IC50 | 390±n/a nM |
---|
Citation | Nie, S; Yao, Y; Wu, F; Wu, X; Zhao, J; Hua, Y; Wu, J; Huo, T; Lin, YL; Kneubehl, AR; Vogt, MB; Ferreon, J; Rico-Hesse, R; Song, Y Synthesis, Structure-Activity Relationships, and Antiviral Activity of Allosteric Inhibitors of Flavivirus NS2B-NS3 Protease. J Med Chem64:2777-2800 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nonstructural protein 3 |
---|
Name: | Nonstructural protein 3 |
Synonyms: | Genome polyprotein | NS3 |
Type: | PROTEIN |
Mol. Mass.: | 7653.58 |
Organism: | Zika virus |
Description: | ChEMBL_119671 |
Residue: | 66 |
Sequence: | AETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMK
RGDLPV
|
|
|
BDBM50567484 |
---|
n/a |
---|
Name | BDBM50567484 |
Synonyms: | CHEMBL4861102 |
Type | Small organic molecule |
Emp. Form. | C28H37N5O |
Mol. Mass. | 459.6263 |
SMILES | CN(C)Cc1ccc(cc1)-c1ncc(OCC2CCNCC2)nc1-c1ccc(CN(C)C)cc1 |
Structure |
|