| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nonstructural protein 3 |
|---|
| Ligand | BDBM50567470 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2103470 (CHEMBL4811973) |
|---|
| IC50 | 400±n/a nM |
|---|
| Citation |  Nie, S; Yao, Y; Wu, F; Wu, X; Zhao, J; Hua, Y; Wu, J; Huo, T; Lin, YL; Kneubehl, AR; Vogt, MB; Ferreon, J; Rico-Hesse, R; Song, Y Synthesis, Structure-Activity Relationships, and Antiviral Activity of Allosteric Inhibitors of Flavivirus NS2B-NS3 Protease. J Med Chem64:2777-2800 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nonstructural protein 3 |
|---|
| Name: | Nonstructural protein 3 |
|---|
| Synonyms: | Genome polyprotein | NS3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 7653.58 |
|---|
| Organism: | Zika virus |
|---|
| Description: | ChEMBL_119671 |
|---|
| Residue: | 66 |
|---|
| Sequence: | AETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMK
RGDLPV
|
|
|
|---|
| BDBM50567470 |
|---|
| n/a |
|---|
| Name | BDBM50567470 |
|---|
| Synonyms: | CHEMBL4862353 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H29N5O |
|---|
| Mol. Mass. | 439.5521 |
|---|
| SMILES | NCc1ccc(cc1)-c1ncc(NCC2CCNCC2)nc1-c1ccc(cc1)-c1ccoc1 |
|---|
| Structure | 
|
|---|
Search and Browse
