| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Ligand | BDBM194954 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2155251 (CHEMBL5039911) |
|---|
| IC50 | 2.8±n/a nM |
|---|
| Citation |  Jiang, J; Ding, FX; Zhou, X; Bateman, TJ; Dong, S; Gu, X; Keh deJesus, R; Pio, B; Tang, H; Chobanian, HR; Levorse, D; Hu, M; Thomas-Fowlkes, B; Margulis, M; Koehler, M; Weinglass, A; Gibson, J; Houle, K; Yudkovitz, J; Hampton, C; Pai, LY; Samuel, K; Cutarelli, T; Sullivan, K; Parmee, ER; Davies, I; Pasternak, A Discovery of MK-8153, a Potent and Selective ROMK Inhibitor and Novel Diuretic/Natriuretic. J Med Chem64:7691-7701 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Name: | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | KCNJ1_RAT | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK) | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44976.27 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P35560 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
|---|
| BDBM194954 |
|---|
| n/a |
|---|
| Name | BDBM194954 |
|---|
| Synonyms: | US9206198, 7 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28N2O6 |
|---|
| Mol. Mass. | 440.4889 |
|---|
| SMILES | CC1=C(COC1=O)N1CCC2(CCN(C[C@H](O)c3ccc4C(=O)OCc4c3C)CC2)C1=O |r,t:1| |
|---|
| Structure | 
|
|---|
Search and Browse
