| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Elongation of very long chain fatty acids protein 7 |
|---|
| Ligand | BDBM50596133 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2219491 (CHEMBL5132825) |
|---|
| IC50 | >500000±n/a nM |
|---|
| Citation |  Come, JH; Senter, TJ; Clark, MP; Court, JJ; Gale-Day, Z; Gu, W; Krueger, E; Liang, J; Morris, M; Nanthakumar, S; O'Dowd, H; Maltais, F; Iyer, G; Andreassi, J; Boucher, C; Considine, T; Moody, CS; Taylor, W; Mohanty, AK; Huang, Y; Zuccola, H; Coll, J; Bonanno, KC; Gagnon, KJ; Gan, L; Lu, F; Gao, H; Chakilam, A; Engtrakul, J; Song, B; Crawford, D; Doyle, E; Kramer, T; Vought, B; Phillips, J; Kemper, R; Sanders, M; Swett, R; Furey, B; Winquist, R; Bunnage, ME; Jackson, KL; Charifson, PS; Magavi, SS Discovery and Optimization of Pyrazole Amides as Inhibitors of ELOVL1. J Med Chem64:17753-17776 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Elongation of very long chain fatty acids protein 7 |
|---|
| Name: | Elongation of very long chain fatty acids protein 7 |
|---|
| Synonyms: | 2.3.1.199 | 3-keto acyl-CoA synthase ELOVL7 | ELOV7_HUMAN | ELOVL FA elongase 7 | ELOVL fatty acid elongase 7 | ELOVL7 | Very long chain 3-ketoacyl-CoA synthase 7 | Very long chain 3-oxoacyl-CoA synthase 7 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33372.05 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_120633 |
|---|
| Residue: | 281 |
|---|
| Sequence: | MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRK
PFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLY
YFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAV
HVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFAC
IIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN
|
|
|
|---|
| BDBM50596133 |
|---|
| n/a |
|---|
| Name | BDBM50596133 |
|---|
| Synonyms: | CHEMBL5081193 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H14F2N4O |
|---|
| Mol. Mass. | 340.3268 |
|---|
| SMILES | Fc1cc(ccn1)-n1ccc(NC(=O)C2(CC2)c2ccccc2F)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
