| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-1 |
|---|
| Ligand | BDBM50077225 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2250691 (CHEMBL5164901) |
|---|
| Kd | 24000±n/a nM |
|---|
| Citation |  Bum-Erdene, K; Collins, PM; Hugo, MW; Tarighat, SS; Fei, F; Kishor, C; Leffler, H; Nilsson, UJ; Groffen, J; Grice, ID; Heisterkamp, N; Blanchard, H Novel Selective Galectin-3 Antagonists Are Cytotoxic to Acute Lymphoblastic Leukemia. J Med Chem65:5975-5989 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-1 |
|---|
| Name: | Galectin-1 |
|---|
| Synonyms: | 14 kDa lectin | Galaptin | HPL | LEG1_HUMAN | LGALS1 | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12 |
|---|
| Type: | beta galactoside-binding protein |
|---|
| Mol. Mass.: | 14713.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09382 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
|
|
|
|---|
| BDBM50077225 |
|---|
| n/a |
|---|
| Name | BDBM50077225 |
|---|
| Synonyms: | (2R,3R,4S,5R,6S)-2-(hydroxymethyl)-6-{[(2S,3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl]thio}tetrahydro-2H-pyran-3,4,5-triol | CHEMBL52011 | THIODIGALACTOSIDE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H22O10S |
|---|
| Mol. Mass. | 358.362 |
|---|
| SMILES | OC[C@H]1O[C@@H](S[C@@H]2O[C@H](CO)[C@H](O)[C@H](O)[C@H]2O)[C@H](O)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
