| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50408674 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2267987 |
|---|
| Ki | 49±n/a nM |
|---|
| Citation |  Huang, H; Li, X; Xie, P; Li, X; Xu, X; Qian, Y; Yuan, C; Meng, X; Chai, J; Chen, J; Liu, J; Wang, W; Li, W; Wang, Y; Fu, W; Liu, J Discovery, Structure-Activity Relationship, and Mechanistic Studies of 1-((3 J Med Chem64:9458-9483 (2021) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50408674 |
|---|
| n/a |
|---|
| Name | BDBM50408674 |
|---|
| Synonyms: | CHEMBL5282901 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H27ClN2O3 |
|---|
| Mol. Mass. | 402.914 |
|---|
| SMILES | CN(C)CC1CN(CCC1(O)c1cccc(O)c1)C(=O)Cc1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
