| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Diacylglycerol acyltransferase/mycolyltransferase Ag85C |
|---|
| Ligand | BDBM50148590 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_431881 (CHEMBL915964) |
|---|
| IC50 | 1300±n/a nM |
|---|
| Citation |  Gobec, S; Plantan, I; Mravljak, J; Svajger, U; Wilson, RA; Besra, GS; Soares, SL; Appelberg, R; Kikelj, D Design, synthesis, biochemical evaluation and antimycobacterial action of phosphonate inhibitors of antigen 85C, a crucial enzyme involved in biosynthesis of the mycobacterial cell wall. Eur J Med Chem42:54-63 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Diacylglycerol acyltransferase/mycolyltransferase Ag85C |
|---|
| Name: | Diacylglycerol acyltransferase/mycolyltransferase Ag85C |
|---|
| Synonyms: | A85C_MYCTU | Fibonectin-binding protein C | fbpC | mpt45 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 36770.32 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_431881 |
|---|
| Residue: | 340 |
|---|
| Sequence: | MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVP
SASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQS
SFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILA
AYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQ
IPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
|
|
|
|---|
| BDBM50148590 |
|---|
| n/a |
|---|
| Name | BDBM50148590 |
|---|
| Synonyms: | (1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-methyl ethylheptylphosphonate | CHEMBL118252 | Heptyl-phosphonic acid 1,3-dioxo-1,3-dihydro-isoindol-2-ylmethyl ester ethyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H26NO5P |
|---|
| Mol. Mass. | 367.3765 |
|---|
| SMILES | CCCCCCCP(=O)(OCC)OCN1C(=O)c2ccccc2C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
