Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | G-protein coupled bile acid receptor 1 |
---|
Ligand | BDBM50613575 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2292574 |
---|
EC50 | 26±n/a nM |
---|
Citation | Kuhn, B; Guba, W; Hert, J; Banner, D; Bissantz, C; Ceccarelli, S; Haap, W; Körner, M; Kuglstatter, A; Lerner, C; Mattei, P; Neidhart, W; Pinard, E; Rudolph, MG; Schulz-Gasch, T; Woltering, T; Stahl, M A Real-World Perspective on Molecular Design. J Med Chem59:4087-102 (2016) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G-protein coupled bile acid receptor 1 |
---|
Name: | G-protein coupled bile acid receptor 1 |
Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 35260.02 |
Organism: | Homo sapiens (Human) |
Description: | CHO cells transiently transfected with hTGR5. |
Residue: | 330 |
Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
BDBM50613575 |
---|
n/a |
---|
Name | BDBM50613575 |
Synonyms: | CHEMBL5289884 |
Type | Small organic molecule |
Emp. Form. | C28H21Cl2N3O5S |
Mol. Mass. | 582.454 |
SMILES | Cc1cc(NC(=O)c2cc(Cl)c(Oc3ncccc3C(=O)N3CCCc4ccccc34)cc2Cl)sc1C(O)=O |
Structure |
|