Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | B1 bradykinin receptor |
---|
Ligand | BDBM50209724 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_434360 (CHEMBL919419) |
---|
Ki | 8.9±n/a nM |
---|
Citation | Biswas, K; Li, A; Chen, JJ; D'Amico, DC; Fotsch, C; Han, N; Human, J; Liu, Q; Norman, MH; Riahi, B; Yuan, C; Suzuki, H; Mareska, DA; Zhan, J; Clarke, DE; Toro, A; Groneberg, RD; Burgess, LE; Lester-Zeiner, D; Biddlecome, G; Manning, BH; Arik, L; Dong, H; Huang, M; Kamassah, A; Loeloff, R; Sun, H; Hsieh, FY; Kumar, G; Ng, GY; Hungate, RW; Askew, BC; Johnson, E Potent nonpeptide antagonists of the bradykinin B1 receptor: structure-activity relationship studies with novel diaminochroman carboxamides. J Med Chem50:2200-12 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
B1 bradykinin receptor |
---|
Name: | B1 bradykinin receptor |
Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
Type: | Enzyme |
Mol. Mass.: | 40508.87 |
Organism: | Homo sapiens (Human) |
Description: | P46663 |
Residue: | 353 |
Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
BDBM50209724 |
---|
n/a |
---|
Name | BDBM50209724 |
Synonyms: | (R)-N-((R)-7-((ethylamino)methyl)chroman-4-yl)-3-(naphthalene-3-sulfonamido)-3-phenylpropanamide | CHEMBL224071 |
Type | Small organic molecule |
Emp. Form. | C31H33N3O4S |
Mol. Mass. | 543.676 |
SMILES | CCNCc1ccc2[C@@H](CCOc2c1)NC(=O)C[C@@H](NS(=O)(=O)c1ccc2ccccc2c1)c1ccccc1 |
Structure |
|