| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cysteinyl leukotriene receptor 1 |
|---|
| Ligand | BDBM50001285 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_99863 (CHEMBL706933) |
|---|
| IC50 | 3.90±n/a nM |
|---|
| Citation |  Labelle, M; Prasit, P; Belley, M; Blouin, M; Champion, E; Charette, L; DeLuca, JG; Dufresne, C; Frenette, R; Gauthier, JY; Grimm, E; Grossman, SJ; Guay, D; Herold, EG; Jones, TR; Lau, CK; Leblanc, Y; Léger, S; Lord, A; McAuliffe, M The discovery of a new structural class of potent orally active leukotriene D4 antagonists Bioorg Med Chem Lett2:1141-1146 (1992) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cysteinyl leukotriene receptor 1 |
|---|
| Name: | Cysteinyl leukotriene receptor 1 |
|---|
| Synonyms: | CLTR1_CAVPO | CYSLTR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39007.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | Leukotriene D4 0 GUINEA PIG::Q2NNR5 |
|---|
| Residue: | 340 |
|---|
| Sequence: | MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
|
|
|
|---|
| BDBM50001285 |
|---|
| n/a |
|---|
| Name | BDBM50001285 |
|---|
| Synonyms: | (E)-3-((3-(2-(7-chloroquinolin-2-yl)vinyl)phenyl)(3-(dimethylamino)-3-oxopropylthio)methylthio)propanoic acid | 3-(((3-(2-(7-chloroquinoline-2-yl)ethenyl)phenyl)((3-dimethylamino-3-oxopropyl)thio)methyl)thio)propanoic acid | 3-((3-(2-(7-chloroquinolin-2-yl)vinyl)phenyl)(3-(dimethylamino)-3-oxopropylthio)methylthio)propanoic acid | 3-[{3-[(E)-2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-diethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid | 3-[{3-[(E)-2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid | 3-[{3-[2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid(MK-571) | 3-[{3-[2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid(MK-571, L-660711) | CHEMBL15177 | L-660711 | MK 571 | MK-571 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H27ClN2O3S2 |
|---|
| Mol. Mass. | 515.087 |
|---|
| SMILES | CN(C)C(=O)CCSC(SCCC(O)=O)c1cccc(\C=C\c2ccc3ccc(Cl)cc3n2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
