Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50285909 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_79817 (CHEMBL695236) |
---|
IC50 | 11±n/a nM |
---|
Citation | Kempf, DJ; Flentge, CA; Wideburg, NE; Saldivar, A; Vasavanonda, S; Norbeck, DW Evaluation of substituted benzamides as P2 ligands for symmetry-based inhibitors of HIV protease Bioorg Med Chem Lett5:2725-2728 (1995) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50285909 |
---|
n/a |
---|
Name | BDBM50285909 |
Synonyms: | CHEMBL91443 | [(1S,3S,4S)-4-(4-Amino-3-hydroxy-benzoylamino)-1-benzyl-3-hydroxy-5-phenyl-pentyl]-carbamic acid tert-butyl ester |
Type | Small organic molecule |
Emp. Form. | C30H37N3O5 |
Mol. Mass. | 519.6319 |
SMILES | CC(C)(C)OC(=O)N[C@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)c1ccc(N)c(O)c1)Cc1ccccc1 |
Structure |
|