Reaction Details |
| Report a problem with these data |
Target | Bcl-2-related protein A1 |
---|
Ligand | BDBM39157 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_676083 (CHEMBL1273077) |
---|
IC50 | 6200±n/a nM |
---|
Citation | Cashman, JR; MacDonald, M; Ghirmai, S; Okolotowicz, KJ; Sergienko, E; Brown, B; Garcia, X; Zhai, D; Dahl, R; Reed, JC Inhibition of Bfl-1 with N-aryl maleimides. Bioorg Med Chem Lett20:6560-4 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-related protein A1 |
---|
Name: | Bcl-2-related protein A1 |
Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
Type: | Apoptosis regulator protein |
Mol. Mass.: | 20130.01 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 175 |
Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
BDBM39157 |
---|
n/a |
---|
Name | BDBM39157 |
Synonyms: | 3-chloranyl-1-(3,4-dichlorophenyl)-4-[4-(2-methoxyphenyl)piperazin-1-yl]pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-(4-(2-methoxyphenyl)piperazin-1-yl)-1H-pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-[4-(2-methoxyphenyl)-1-piperazinyl]pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-[4-(2-methoxyphenyl)piperazin-1-yl]pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-[4-(2-methoxyphenyl)piperazino]-3-pyrroline-2,5-quinone | CHEMBL1272209 | MLS-0090875.0001 | cid_16654670 |
Type | Small organic molecule |
Emp. Form. | C21H18Cl3N3O3 |
Mol. Mass. | 466.745 |
SMILES | COc1ccccc1N1CCN(CC1)C1=C(Cl)C(=O)N(C1=O)c1ccc(Cl)c(Cl)c1 |c:16| |
Structure |
|