| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50041505 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_37642 (CHEMBL650286) |
|---|
| IC50 | 9.1±n/a nM |
|---|
| Citation |  Greco, G; Novellino, E; Fiorini, I; Nacci, V; Campiani, G; Ciani, SM; Garofalo, A; Bernasconi, P; Mennini, T A comparative molecular field analysis model for 6-arylpyrrolo[2,1-d] [1,5]benzothiazepines binding selectively to the mitochondrial benzodiazepine receptor. J Med Chem37:4100-8 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50041505 |
|---|
| n/a |
|---|
| Name | BDBM50041505 |
|---|
| Synonyms: | CHEMBL33096 | Dimethyl-carbamic acid 5-(4-methoxy-phenyl)-6-thia-10b-aza-benzo[e]azulen-4-yl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20N2O3S |
|---|
| Mol. Mass. | 392.471 |
|---|
| SMILES | COc1ccc(cc1)C1=C(OC(=O)N(C)C)c2cccn2-c2ccccc2S1 |c:9| |
|---|
| Structure | 
|
|---|
Search and Browse
