Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50056938 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_88782 (CHEMBL699440) |
---|
IC50 | 1500±n/a nM |
---|
Citation | Neamati, N; Hong, H; Mazumder, A; Wang, S; Sunder, S; Nicklaus, MC; Milne, GW; Proksa, B; Pommier, Y Depsides and depsidones as inhibitors of HIV-1 integrase: discovery of novel inhibitors through 3D database searching. J Med Chem40:942-51 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | Human immunodeficiency virus type 2 integrase |
Type: | PROTEIN |
Mol. Mass.: | 10781.73 |
Organism: | Human immunodeficiency virus 2 |
Description: | ChEMBL_88781 |
Residue: | 95 |
Sequence: | IPQETGRQTALFLLKLASRWPITHLHTDNGSNFTSQEVKMVAWWIGIEQSFGVPYNPQSQ
GVVEAMNHHLKNQISRIREQANTVETIVLVAVHCM
|
|
|
BDBM50056938 |
---|
n/a |
---|
Name | BDBM50056938 |
Synonyms: | 2,6,7-Trihydroxy-9-methyl-xanthen-3-one | CHEMBL175266 | NSC-66209 | US20230364057, Compound 75 | cid_72721 |
Type | Small organic molecule |
Emp. Form. | C14H10O5 |
Mol. Mass. | 258.2262 |
SMILES | Cc1c2cc(O)c(O)cc2oc2cc(=O)c(O)cc12 |
Structure |
|