Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50073625 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_88621 (CHEMBL701725) |
---|
IC50 | 8360±n/a nM |
---|
Citation | King, PJ; Ma, G; Miao, W; Jia, Q; McDougall, BR; Reinecke, MG; Cornell, C; Kuan, J; Kim, TR; Robinson, WE Structure-activity relationships: analogues of the dicaffeoylquinic and dicaffeoyltartaric acids as potent inhibitors of human immunodeficiency virus type 1 integrase and replication. J Med Chem42:497-509 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | Human immunodeficiency virus type 1 integrase |
Type: | PROTEIN |
Mol. Mass.: | 32231.48 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_90865 |
Residue: | 288 |
Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50073625 |
---|
n/a |
---|
Name | BDBM50073625 |
Synonyms: | (Z)-3-(3,4-Dihydroxy-phenyl)-acrylic acid 2-[(Z)-3-(3,4-dihydroxy-phenyl)-acryloyloxy]-cyclohexyl ester | CHEMBL149305 |
Type | Small organic molecule |
Emp. Form. | C24H24O8 |
Mol. Mass. | 440.4426 |
SMILES | Oc1ccc(\C=C/C(=O)OC2CCCCC2OC(=O)\C=C/c2ccc(O)c(O)c2)cc1O |
Structure |
|