Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50098466 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_146896 (CHEMBL751670) |
---|
Ki | 68±n/a nM |
---|
Citation | Thomas, JB; Herault, XM; Rothman, RB; Atkinson, RN; Burgess, JP; Mascarella, SW; Dersch, CM; Xu, H; Flippen-Anderson, JL; George, CF; Carroll, FI Factors influencing agonist potency and selectivity for the opioid delta receptor are revealed in structure-activity relationship studies of the 4-[(N-substituted-4-piperidinyl)arylamino]-N,N-diethylbenzamides. J Med Chem44:972-87 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50098466 |
---|
n/a |
---|
Name | BDBM50098466 |
Synonyms: | CHEMBL175511 | N,N-Diethyl-4-{[3-methyl-1-(3-phenyl-allyl)-piperidin-4-yl]-phenyl-amino}-benzamide |
Type | Small organic molecule |
Emp. Form. | C32H39N3O |
Mol. Mass. | 481.6716 |
SMILES | CCN(CC)C(=O)c1ccc(cc1)N([C@@H]1CCN(C\C=C\c2ccccc2)C[C@@H]1C)c1ccccc1 |
Structure |
|