Reaction Details |
| Report a problem with these data |
Target | D(3) dopamine receptor |
---|
Ligand | BDBM50145073 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_62262 (CHEMBL675664) |
---|
Ki | 560±n/a nM |
---|
Citation | Cowart, M; Latshaw, SP; Bhatia, P; Daanen, JF; Rohde, J; Nelson, SL; Patel, M; Kolasa, T; Nakane, M; Uchic, ME; Miller, LN; Terranova, MA; Chang, R; Donnelly-Roberts, DL; Namovic, MT; Hollingsworth, PR; Martino, BR; Lynch, JJ; Sullivan, JP; Hsieh, GC; Moreland, RB; Brioni, JD; Stewart, AO Discovery of 2-(4-pyridin-2-ylpiperazin-1-ylmethyl)-1H-benzimidazole (ABT-724), a dopaminergic agent with a novel mode of action for the potential treatment of erectile dysfunction. J Med Chem47:3853-64 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
D(3) dopamine receptor |
---|
Name: | D(3) dopamine receptor |
Synonyms: | DOPAMINE D3 | DRD3 | DRD3_HUMAN | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3 |
Type: | n/a |
Mol. Mass.: | 44243.43 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 400 |
Sequence: | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
|
|
|
BDBM50145073 |
---|
n/a |
---|
Name | BDBM50145073 |
Synonyms: | 5-Fluoro-2-(4-pyridin-2-yl-piperazin-1-ylmethyl)-1H-indole | CHEMBL77395 | CP-226269 |
Type | Small organic molecule |
Emp. Form. | C18H19FN4 |
Mol. Mass. | 310.3687 |
SMILES | Fc1ccc2[nH]c(CN3CCN(CC3)c3ccccn3)cc2c1 |
Structure |
|