| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50080467 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_146906 (CHEMBL751119) |
|---|
| Ki | 2.2±n/a nM |
|---|
| Citation |  Ananthan, S; Khare, NK; Saini, SK; Seitz, LE; Bartlett, JL; Davis, P; Dersch, CM; Porreca, F; Rothman, RB; Bilsky, EJ Identification of opioid ligands possessing mixed micro agonist/delta antagonist activity among pyridomorphinans derived from naloxone, oxymorphone, and hydromorphone [correction of hydropmorphone]. J Med Chem47:1400-12 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50080467 |
|---|
| n/a |
|---|
| Name | BDBM50080467 |
|---|
| Synonyms: | 5'-(Chlorophenyl)-17-(cyclopropylmethyl) -6,7-didehydro-3,14-dihydroxy-4,5alpha-epoxypyrido-[2',3':6,7]morphinan | CHEMBL325600 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H27ClN2O3 |
|---|
| Mol. Mass. | 486.989 |
|---|
| SMILES | Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45C(Oc1c24)c1ncc(cc1C[C@@]35O)-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
