| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Ligand | BDBM50173562 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_320965 (CHEMBL885372) |
|---|
| Ki | 217000±n/a nM |
|---|
| Citation |  Nguyen, C; Kasinathan, G; Leal-Cortijo, I; Musso-Buendia, A; Kaiser, M; Brun, R; Ruiz-Pérez, LM; Johansson, NG; González-Pacanowska, D; Gilbert, IH Deoxyuridine triphosphate nucleotidohydrolase as a potential antiparasitic drug target. J Med Chem48:5942-54 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Synonyms: | dUTP pyrophosphatase |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 19574.43 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | Q8II92 |
|---|
| Residue: | 173 |
|---|
| Sequence: | MHLKIVCLSDEVREMYKNHKTHHEGDSGLDLFIVKDEVLKPKSTTFVKLGIKAIALQYKS
NYYYKCEKSENKKKDDDKSNIVNTSFLLFPRSSISKTPLRLANSIGLIDAGYRGEIIAAL
DNTSDQEYHIKKNDKLVQLVSFTGEPLSFELVEELDETSRGEGGFGSTSNNKY
|
|
|
|---|
| BDBM50173562 |
|---|
| n/a |
|---|
| Name | BDBM50173562 |
|---|
| Synonyms: | (Diethoxy-phosphoryl)-acetic acid 3-(tert-butyl-dimethyl-silanyloxy)-5-(2,4-dioxo-3,4-dihydro-2H-pyrimidin-1-yl)-tetrahydro-furan-2-ylmethyl ester | CHEMBL3143772 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H37N2O9PSi |
|---|
| Mol. Mass. | 520.5857 |
|---|
| SMILES | CCOP(=O)(CC(=O)OC[C@H]1O[C@H](C[C@@H]1O[Si](C)(C)C(C)(C)C)n1ccc(=O)[nH]c1=O)OCC |r| |
|---|
| Structure | 
|
|---|
Search and Browse
