| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50270040 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_508149 (CHEMBL1007398) |
|---|
| IC50 | 220±n/a nM |
|---|
| Citation |  Méthot, N; Rubin, J; Guay, D; Beaulieu, C; Ethier, D; Reddy, TJ; Riendeau, D; Percival, MD Inhibition of the activation of multiple serine proteases with a cathepsin C inhibitor requires sustained exposure to prevent pro-enzyme processing. J Biol Chem282:20836-46 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50270040 |
|---|
| n/a |
|---|
| Name | BDBM50270040 |
|---|
| Synonyms: | (S)-1-((1R,2R)-1-cyano-2-phenylcyclopropylamino)-1-oxo-3-(thiophen-2-yl)propan-2-aminium 2,2,2-trifluoroacetate | CHEMBL516292 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H18N3OS |
|---|
| Mol. Mass. | 312.409 |
|---|
| SMILES | [NH3+][C@@H](Cc1cccs1)C(=O)N[C@@]1(C[C@@H]1c1ccccc1)C#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
