Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM50302837 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_595447 (CHEMBL1045212) |
---|
IC50 | 170±n/a nM |
---|
Citation | Sealy, JM; Truong, AP; Tso, L; Probst, GD; Aquino, J; Hom, RK; Jagodzinska, BM; Dressen, D; Wone, DW; Brogley, L; John, V; Tung, JS; Pleiss, MA; Tucker, JA; Konradi, AW; Dappen, MS; Toth, G; Pan, H; Ruslim, L; Miller, J; Bova, MP; Sinha, S; Quinn, KP; Sauer, JM Design and synthesis of cell potent BACE-1 inhibitors: structure-activity relationship of P1' substituents. Bioorg Med Chem Lett19:6386-91 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM50302837 |
---|
n/a |
---|
Name | BDBM50302837 |
Synonyms: | CHEMBL572313 | N-((2S,3R)-4-(3-(3-(1H-pyrazol-1-yl)phenyl)tetrahydro-2H-pyran-3-ylamino)-1-(3,5-difluorophenyl)-3-hydroxybutan-2-yl)acetamide |
Type | Small organic molecule |
Emp. Form. | C26H30F2N4O3 |
Mol. Mass. | 484.5382 |
SMILES | CC(=O)N[C@@H](Cc1cc(F)cc(F)c1)[C@H](O)CNC1(CCCOC1)c1cccc(c1)-n1cccn1 |r| |
Structure |
|