Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase 16 |
---|
Ligand | BDBM16673 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_586858 (CHEMBL1051353) |
---|
Kd | >10000±n/a nM |
---|
Citation | Karaman, MW; Herrgard, S; Treiber, DK; Gallant, P; Atteridge, CE; Campbell, BT; Chan, KW; Ciceri, P; Davis, MI; Edeen, PT; Faraoni, R; Floyd, M; Hunt, JP; Lockhart, DJ; Milanov, ZV; Morrison, MJ; Pallares, G; Patel, HK; Pritchard, S; Wodicka, LM; Zarrinkar, PP A quantitative analysis of kinase inhibitor selectivity. Nat Biotechnol26:127-32 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase 16 |
---|
Name: | Serine/threonine-protein kinase 16 |
Synonyms: | MPSK1 | PKL12 | STK16 | STK16_HUMAN | Serine/threonine-protein kinase 16 | TSF1 | Tyrosine-protein kinase STK16 (STK16) |
Type: | Protein |
Mol. Mass.: | 34659.07 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 305 |
Sequence: | MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDRE
EAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFL
TEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGS
RQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQ
KGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEALQPPAPGQ
HTTQI
|
|
|
BDBM16673 |
---|
n/a |
---|
Name | BDBM16673 |
Synonyms: | 4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide | 4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid | BAY 43-9006 | BAY 439006 | BAY439006 | CHEMBL1336 | Hit compound, 8 | Nexavar | Sorafenib | Sorafenib, 4 | US10183928, Sorafenib | US10202365, Compound Sorafenib | US10227329, Compound Sorafenib | US10584114, Compound Sorafenib | US10774070, Compound Sorafenib | US10980809, Example Sorafenib | US11279688, Compound Sorafenib | US11505527, Compound Sorafenib | US11912663, Compound Sorafenib | US9029401, Sorafenib | US9469639, Sorafenib | US9902709, Comparative example 1 | Xarelto | cid_216239 |
Type | Small organic molecule |
Emp. Form. | C21H16ClF3N4O3 |
Mol. Mass. | 464.825 |
SMILES | CNC(=O)c1cc(Oc2ccc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)cc2)ccn1 |
Structure |
|