Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 4 |
---|
Ligand | BDBM50402737 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_886913 (CHEMBL2211869) |
---|
EC50 | 106±n/a nM |
---|
Citation | Aguilar, N; Mir, M; Grima, PM; López, M; Segarra, V; Esteban, L; Moreno, I; Godessart, N; Tarrasón, G; Domenech, T; Vilella, D; Armengol, C; Córdoba, M; Sabaté, M; Casals, D; Domínguez, M Discovery of a novel class of zwitterionic, potent, selective and orally active S1P1 direct agonists. Bioorg Med Chem Lett22:7672-6 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 4 |
---|
Name: | Sphingosine 1-phosphate receptor 4 |
Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41647.39 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 384 |
Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
BDBM50402737 |
---|
n/a |
---|
Name | BDBM50402737 |
Synonyms: | CHEMBL2207778 |
Type | Small organic molecule |
Emp. Form. | C24H25FN4O3S |
Mol. Mass. | 468.544 |
SMILES | CCCCN(C(=O)c1ccccc1F)c1nnc(s1)-c1ccc(CN2CC(C2)C(O)=O)cc1 |
Structure |
|