Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50424308 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_935039 (CHEMBL2320904) |
---|
IC50 | 4100±n/a nM |
---|
Citation | Lee, K; Pham, VC; Choi, MJ; Kim, KJ; Lee, KT; Han, SG; Yu, YG; Lee, JY Fragment-based discovery of novel and selective mPGES-1 inhibitors Part 1: identification of sulfonamido-1,2,3-triazole-4,5-dicarboxylic acid. Bioorg Med Chem Lett23:75-80 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50424308 |
---|
n/a |
---|
Name | BDBM50424308 |
Synonyms: | CHEMBL2314483 |
Type | Small organic molecule |
Emp. Form. | C12H12N4O6S |
Mol. Mass. | 340.312 |
SMILES | OC(=O)c1nnn(CCNS(=O)(=O)c2ccccc2)c1C(O)=O |
Structure |
|