| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50443839 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1455679 (CHEMBL3366024) |
|---|
| IC50 | 1900±n/a nM |
|---|
| Citation |  Hanke, T; Lamers, C; Gomez, RC; Schneider, G; Werz, O; Schubert-Zsilavecz, M Identification of pirinixic acid derivatives bearing a 2-aminothiazole moiety combines dual PPARa/¿ activation and dual 5-LO/mPGES-1 inhibition. Bioorg Med Chem Lett24:3757-63 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50443839 |
|---|
| n/a |
|---|
| Name | BDBM50443839 |
|---|
| Synonyms: | CHEMBL3094410 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H27ClN4O3S2 |
|---|
| Mol. Mass. | 519.079 |
|---|
| SMILES | CCCCCCC(Sc1nc(Cl)cc(Nc2nc-3c(CCc4cc(OC)ccc-34)s2)n1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
