Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50062721 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1462977 (CHEMBL3398721) |
---|
IC50 | 8700±n/a nM |
---|
Citation | Flesch, D; Ness, J; Lamers, C; Dehm, F; Popella, S; Steri, R; Ogorek, I; Hieke, M; Dannhardt, G; Werz, O; Weggen, S; Schubert-Zsilavecz, M SAR-studies of¿-secretase modulators with PPAR¿-agonistic and 5-lipoxygenase-inhibitory activity for Alzheimer's disease. Bioorg Med Chem Lett25:841-6 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50062721 |
---|
n/a |
---|
Name | BDBM50062721 |
Synonyms: | CHEMBL3397724 |
Type | Small organic molecule |
Emp. Form. | C34H38F3NO6 |
Mol. Mass. | 613.6638 |
SMILES | CCCC\C(=C/c1cc(OCc2ccc(OCCN3CCOCC3)cc2)ccc1OCc1ccc(cc1)C(F)(F)F)C(O)=O |
Structure |
|