Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | RCG38204, isoform CRA_d |
---|
Ligand | BDBM50427221 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1517183 (CHEMBL3620073) |
---|
Ki | 5890±n/a nM |
---|
Citation | Katane, M; Yamada, S; Kawaguchi, G; Chinen, M; Matsumura, M; Ando, T; Doi, I; Nakayama, K; Kaneko, Y; Matsuda, S; Saitoh, Y; Miyamoto, T; Sekine, M; Yamaotsu, N; Hirono, S; Homma, H Identification of Novel D-Aspartate Oxidase Inhibitors by in Silico Screening and Their Functional and Structural Characterization in Vitro. J Med Chem58:7328-40 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
RCG38204, isoform CRA_d |
---|
Name: | RCG38204, isoform CRA_d |
Synonyms: | D-aspartate oxidase | Ddo | Ensembl:ENSRNOP00000000710 | LOC100911156 | Protein Ddo | RCG38204, isoform CRA_d | RGD:1595123 |
Type: | PROTEIN |
Mol. Mass.: | 37549.70 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_109876 |
Residue: | 341 |
Sequence: | MDTVRIAVVGAGVIGLSTAACVSQLVPRCSVTVISDRFTPDTTSNVAAGMLIPPTYPDTP
VPTLKRWFRETFQHLSEIARSAEAVDAGIHLVSGWQIFRSVPTEEVPFWADVVLGFREMT
EAELKRFPQYEFGQAFTTLKCETSAYLPWLEKRIKGSGGLLLTRRIEDLWELQPSFDIVV
NCSGLGSRRLVGDATVSPVRGQVLQAQAPWVKHFIRDGGGLTYVYPGTSYVTLGGSRQTG
DWNLSPDAELSREIFSRCCALEPSLHRACDIKEKVGLRPSRPGVRLQKEILVRGEQRLPV
VHNYGHGSGGISVHWGSALEATRLVMECVHTLRTPASLSKL
|
|
|
BDBM50427221 |
---|
n/a |
---|
Name | BDBM50427221 |
Synonyms: | 5-Aminonicotinic Acid | CHEMBL1491941 |
Type | Small organic molecule |
Emp. Form. | C6H6N2O2 |
Mol. Mass. | 138.124 |
SMILES | Nc1cncc(c1)C(O)=O |
Structure |
|