| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50393042 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1552429 (CHEMBL3761680) |
|---|
| IC50 | 555±n/a nM |
|---|
| Citation |  Schiffler, MA; Antonysamy, S; Bhattachar, SN; Campanale, KM; Chandrasekhar, S; Condon, B; Desai, PV; Fisher, MJ; Groshong, C; Harvey, A; Hickey, MJ; Hughes, NE; Jones, SA; Kim, EJ; Kuklish, SL; Luz, JG; Norman, BH; Rathmell, RE; Rizzo, JR; Seng, TW; Thibodeaux, SJ; Woods, TA; York, JS; Yu, XP Discovery and Characterization of 2-Acylaminoimidazole Microsomal Prostaglandin E Synthase-1 Inhibitors. J Med Chem59:194-205 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MPGES-1 | Microsomal prostaglandin E synthase 1 | PGES | PTGES | PTGES_CANLF | Prostaglandin E synthase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17136.74 |
|---|
| Organism: | Canis familiaris |
|---|
| Description: | ChEMBL_109495 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MPPPVLALVSGQALPAFLLCSTLLVIKMYVVAVITGQVRLRKKAFANPEDALRHGGLQYC
RSDQDVDRCLRAHRNDMETIYPFLFLGFVYSFLGPDPFIAQMHFLVFFLGRMVHTVAYLG
KLRAPTRSLAYTVAQLPCASMALQIVWEAACHL
|
|
|
|---|
| BDBM50393042 |
|---|
| n/a |
|---|
| Name | BDBM50393042 |
|---|
| Synonyms: | CHEMBL2152712 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19ClN4O2 |
|---|
| Mol. Mass. | 334.801 |
|---|
| SMILES | CC(C)(C)C(=O)NCc1ccc(Cl)c(c1)C(=O)Nc1ncc[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
