Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | 5-hydroxytryptamine receptor 2C |
---|
Ligand | BDBM50238515 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1663654 (CHEMBL4013335) |
---|
EC50 | 530±n/a nM |
---|
Citation | Carpenter, J; Carpenter, J; Wang, Y; Wang, Y; Wu, G; Wu, G; Feng, J; Feng, J; Ye, XY; Ye, XY; Morales, CL; Morales, CL; Broekema, M; Broekema, M; Rossi, KA; Rossi, KA; Miller, KJ; Miller, KJ; Murphy, BJ; Murphy, BJ; Wu, G; Wu, G; Malmstrom, SE; Malmstrom, SE; Azzara, AV; Azzara, AV; Sher, PM; Sher, PM; Fevig, JM; Fevig, JM; Alt, A; Alt, A; Bertekap, RL; Bertekap, RL; Cullen, MJ; Cullen, MJ; Harper, TM; Harper, TM; Foster, K; Foster, K; Luk, E; Luk, E; Xiang, Q; Xiang, Q; Grubb, MF; Grubb, MF; Robl, JA; Robl, JA; Wacker, DA; Wacker, DA Utilization of an Active Site Mutant Receptor for the Identification of Potent and Selective Atypical 5-HT J Med Chem60:6166-6190 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 2C |
---|
Name: | 5-hydroxytryptamine receptor 2C |
Synonyms: | 5-HT-1C | 5-HT-2C | 5-HT1C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 51836.79 |
Organism: | Homo sapiens (Human) |
Description: | P28335 |
Residue: | 458 |
Sequence: | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
BDBM50238515 |
---|
n/a |
---|
Name | BDBM50238515 |
Synonyms: | CHEMBL4064770 |
Type | Small organic molecule |
Emp. Form. | C18H15N5 |
Mol. Mass. | 301.3452 |
SMILES | CCn1nc(cc1-c1cccnn1)-c1cncc2ccccc12 |
Structure |
|