Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50329609 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
IC50 | 28±n/a nM |
---|
Citation | Anderson, AC; Wright, DL; Frey, KM; Paulsen, JL; Scocchera, EW; Viswanathan, K Heterocyclic analogs of propargyl-linked inhibitors of dihydrofolate reductase US Patent US8853228 Publication Date 10/7/2014 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
Type: | Enzyme |
Mol. Mass.: | 18249.71 |
Organism: | Staphylococcus aureus |
Description: | n/a |
Residue: | 159 |
Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
BDBM50329609 |
---|
n/a |
---|
Name | BDBM50329609 |
Synonyms: | 5-(3-(biphenyl-3-yl)prop-1-ynyl)-6-ethylpyrimidine-2,4-diamine | CHEMBL1270439 |
Type | Small organic molecule |
Emp. Form. | C21H20N4 |
Mol. Mass. | 328.4103 |
SMILES | CCc1nc(N)nc(N)c1C#CCc1cccc(c1)-c1ccccc1 |
Structure |
|