Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase A |
---|
Ligand | BDBM286600 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Surface Plasmon Resonance (SPR) Assay |
---|
pH | 7.4±n/a |
---|
Kd | 1.20±n/a nM |
---|
Comments | extracted |
---|
Citation | Fu, J; Karur, S; Li, X; Lu, P; Mergo, W; Rivkin, A; Sweeney, ZK; Tjandra, M; Weiss, A; Yifru, A Cyclic peptides and use as medicines US Patent US9566312 Publication Date 2/14/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase A |
Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
Type: | Protein |
Mol. Mass.: | 18015.32 |
Organism: | Homo sapiens (Human) |
Description: | P62937 |
Residue: | 165 |
Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
BDBM286600 |
---|
n/a |
---|
Name | BDBM286600 |
Synonyms: | US9566312, Compound 2.18.4 |
Type | Small organic molecule |
Emp. Form. | C68H122N12O13 |
Mol. Mass. | 1315.7689 |
SMILES | CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC(=O)[C@H]([C@H](C)CCN2CCOC[C@@H]2C)N(C)C(=O)[C@@H](C)N(C)C1=O)C(C)C |r| |
Structure |
|