Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM191844 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Luciferase Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 310.15±n/a K |
---|
EC50 | 0.5±n/a nM |
---|
Comments | extracted |
---|
Citation | Vakalopoulos, A; Meibom, D; Nell, P; Sussmeier, F; Albrecht-Kupper, B; Zimmermann, K; Keldenich, J; Schneider, D; Krenz, U Substituted dicyanopyridines and use thereof US Patent US9187428 Publication Date 11/17/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36520.92 |
Organism: | Homo sapiens (Human) |
Description: | P30542 |
Residue: | 326 |
Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
BDBM191844 |
---|
n/a |
---|
Name | BDBM191844 |
Synonyms: | US9187428, 72 |
Type | Small organic molecule |
Emp. Form. | C25H22N6O3S |
Mol. Mass. | 486.546 |
SMILES | CNC(=O)c1cc(CSc2nc(N3CC(O)C3)c(C#N)c(-c3ccc(OC)cc3)c2C#N)ccn1 |
Structure |
|