| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-8 |
|---|
| Ligand | BDBM446610 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Determination of LMP7 Activity |
|---|
| IC50 | <50±n/a nM |
|---|
| Citation |  Klein, M; Schadt, O; Haselmayer, P; Krier, M Boronic acid derivatives US Patent US10669289 Publication Date 6/2/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-8 |
|---|
| Name: | Proteasome subunit beta type-8 |
|---|
| Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30357.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1446797 |
|---|
| Residue: | 276 |
|---|
| Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
|---|
| BDBM446610 |
|---|
| n/a |
|---|
| Name | BDBM446610 |
|---|
| Synonyms: | US10669289, Compound 17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25BN2O4 |
|---|
| Mol. Mass. | 380.245 |
|---|
| SMILES | Cc1ccc(C[C@H](NC(=O)CN(C(=O)C=C)c2ccccc2)B(O)O)cc1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
