| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Potassium channel subfamily K member 3 |
|---|
| Ligand | BDBM458964 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition In Vito Assay |
|---|
| IC50 | 63.0±n/a nM |
|---|
| Citation |  Delbeck, M; Hahn, M; Müller, T; Meier, H; Lustig, K; Mosig, J; Toschi, L; Albus, U; Gehring, D; Rosenstein, B 2-phenyl-3-(piperazinomethyl)imidazo[1,2-A]pyridine derivatives as blockers of task-1 and task-2 channels, for the treatment of sleep-related breathing disorders US Patent US10759794 Publication Date 9/1/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Potassium channel subfamily K member 3 |
|---|
| Name: | Potassium channel subfamily K member 3 |
|---|
| Synonyms: | Acid-sensitive potassium channel TASK-1 | Acid-sensitive potassium channel protein TASK-1 | KCNK3 | KCNK3_HUMAN | Potassium channel protein TASK-1 | Potassium channel subfamily K member 3 | Potassium channel subfamily K member 3 (TASK-1) | TASK | TASK1 | TWIK-related acid-sensitive K(+) channel 1 | Two pore K(+) channel KT3.1 | Two pore potassium channel KT3.1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 43534.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O14649 |
|---|
| Residue: | 394 |
|---|
| Sequence: | MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
|
|
|
|---|
| BDBM458964 |
|---|
| n/a |
|---|
| Name | BDBM458964 |
|---|
| Synonyms: | (4-{[2-(4-Chlorophenyl)imidazo [1,2-a]pyridin-3-yl]methyl}piperazin-1-yl)(cyclopentyl)methanone | US10759794, Example 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H27ClN4O |
|---|
| Mol. Mass. | 422.95 |
|---|
| SMILES | Clc1ccc(cc1)-c1nc2ccccn2c1CN1CCN(CC1)C(=O)C1CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
