| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain testis-specific protein [287-359] |
|---|
| Ligand | BDBM50370182 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Plate-Based Time-Resolved Fluorescence Energy Transfer (TR-FRET) Assays |
|---|
| IC50 | 2781±n/a nM |
|---|
| Citation |  Zhou, J; Brasier, AR; Tian, B; Liu, Z; Chen, H; Rytting, E Inhibitors of bromodomain-containing protein 4 (BRD4) US Patent US11117865 Publication Date 9/14/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain testis-specific protein [287-359] |
|---|
| Name: | Bromodomain testis-specific protein [287-359] |
|---|
| Synonyms: | BRDT | BRDT_HUMAN | Bromodomain testis-specific protein (BRDT)(BD2) |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 8713.30 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q58F21[287-359] |
|---|
| Residue: | 73 |
|---|
| Sequence: | KHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFM
NCYKYNPPDHEVV
|
|
|
|---|
| BDBM50370182 |
|---|
| n/a |
|---|
| Name | BDBM50370182 |
|---|
| Synonyms: | CHEMBL4176038 | US11117865, Compound ZL0420 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16N4O2 |
|---|
| Mol. Mass. | 296.3238 |
|---|
| SMILES | Cc1cc(\N=N\c2ccc3NC(=O)CCc3c2)c(N)cc1O |
|---|
| Structure | 
|
|---|
Search and Browse
