Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bromodomain testis-specific protein [287-359] |
---|
Ligand | BDBM50370182 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Plate-Based Time-Resolved Fluorescence Energy Transfer (TR-FRET) Assays |
---|
IC50 | 2781±n/a nM |
---|
Citation | Zhou, J; Brasier, AR; Tian, B; Liu, Z; Chen, H; Rytting, E Inhibitors of bromodomain-containing protein 4 (BRD4) US Patent US11117865 Publication Date 9/14/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bromodomain testis-specific protein [287-359] |
---|
Name: | Bromodomain testis-specific protein [287-359] |
Synonyms: | BRDT | BRDT_HUMAN | Bromodomain testis-specific protein (BRDT)(BD2) |
Type: | n/a |
Mol. Mass.: | 8713.30 |
Organism: | Homo sapiens (Human) |
Description: | Q58F21[287-359] |
Residue: | 73 |
Sequence: | KHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFM
NCYKYNPPDHEVV
|
|
|
BDBM50370182 |
---|
n/a |
---|
Name | BDBM50370182 |
Synonyms: | CHEMBL4176038 | US11117865, Compound ZL0420 |
Type | Small organic molecule |
Emp. Form. | C16H16N4O2 |
Mol. Mass. | 296.3238 |
SMILES | Cc1cc(\N=N\c2ccc3NC(=O)CCc3c2)c(N)cc1O |
Structure |
|